PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_008515-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family ZF-HD
Protein Properties Length: 82aa    MW: 9014.15 Da    PI: 8.0522
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_008515-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer106.91.2e-332379360
    ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   +vrY eC+kNhAa++Gg+avDGC+Efm+  geegt+aal+CaACgCHRnFHRreve+e
  NNU_008515-RA 23 SVRYGECQKNHAANIGGYAVDGCREFMAG-GEEGTIAALRCAACGCHRNFHRREVETE 79
                   79**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576118No hitNo description
ProDomPD1257749.0E-242481IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047707.6E-312476IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-272576IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.12675IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009741Biological Processresponse to brassinosteroid
GO:0043392Biological Processnegative regulation of DNA binding
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048509Biological Processregulation of meristem development
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
MSIKRGEQTC SSSTTSSCMM RRSVRYGECQ KNHAANIGGY AVDGCREFMA GGEEGTIAAL  60
RCAACGCHRN FHRREVETEL FT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258353.12e-52PREDICTED: mini zinc finger protein 2
SwissprotQ9CA518e-33MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A061EEU83e-35A0A061EEU8_THECC; Mini zinc finger 2 isoform 1
TrEMBLB9T6Z43e-35B9T6Z4_RICCO; Transcription factor, putative
STRINGPOPTR_0004s12510.16e-33(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.12e-33mini zinc finger 1